Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13760' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13760 13760 13760 13760 13760 13760

Label IlvC (no label) (no label) (no label) (no label) (no label)

X 433 369 366 342 359 376

Y 408 391 405 366 402 399

%V 2.1799 1.9246 1.4189 1.6158 6.6332 3.6768

Ratio - 0.739 2.512

p-value - 0.080 0.172

RSD 6.220 6.489 28.676

mean 2.052 1.517 5.155

median 2.052 1.517 5.155

maximum 2.180 1.616 6.633

minimum 1.925 1.419 3.677

	control	1 min	10 min

ID	13760	13760	13760	13760	13760	13760
Label	IlvC	(no label)	(no label)	(no label)	(no label)	(no label)
X	433	369	366	342	359	376
Y	408	391	405	366	402	399
%V	2.1799	1.9246	1.4189	1.6158	6.6332	3.6768
Ratio	-	0.739	2.512
p-value	-	0.080	0.172
RSD	6.220	6.489	28.676
mean	2.052	1.517	5.155
median	2.052	1.517	5.155
maximum	2.180	1.616	6.633
minimum	1.925	1.419	3.677

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		IlvC	IlvC
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	1026	1026
	Protein Size (aa)	342	342
	Function
Uniprot	Accession	A0A0K6MM04
	Amino Acids	336
	Function
	Gene name	ilvC_1
	Gene Ontology	F:isomerase activity [GO:0016853] F:ketol-acid reductoisomerase activity [GO:0004455] P:isoleucine biosynthetic process [GO:0009097] P:valine biosynthetic process [GO:0009099]
	Isoelectric Point	5.0436
	Keywords	Amino-acid biosynthesis Branched-chain amino acid biosynthesis Isomerase NADP Oxidoreductase
	Molecular Weight	36678.64
	NCBI Taxonomy	1423
	Organism	Bacillus subtilis
	Original label name	IlvC
	Protein name	Ketol-acid reductoisomerase
	Query text	IlvC
	References	1 references
	Sequence	MAKVYYEKDVTVNVLKEKKVAIIGYGSQGHAHAQNLRDNGFDVVVGLRKGKSWDKAKEDG FSVYTVAEAAKQADVVMILLPDELQPEVYEAEIAPNLQAGNSLVFAHGFNVHFDQVKPPV NVDVFLVAPKGPGHLVRRTFSEGGAVPALFAVYQDATGVATEKALSYADGIGATRAGVLE TTFKEETETDLFGEQAVLCGGVTALVKAGFETLVDAGYQPELAYFECLHELKLIVDLMYE GGLENMRYSVSDTAQWGDFVSGPRVVTEDTKKAMGAVLAEIQDGTFARGWIAEHKAGRPN FHATNEKENEHEIEVVGRKLREMMPFVQPRVKAGVK
	Title	A0A0K6MM04_BACIU
	Uniprot entry	A0A0K6MM04

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13760	13760	13760	13760	13760	13760
Label	IlvC	(no label)	(no label)	(no label)	(no label)	(no label)
X	433	369	366	342	359	376
Y	408	391	405	366	402	399
%V	2.1799	1.9246	1.4189	1.6158	6.6332	3.6768
Ratio	-		0.739		2.512
p-value	-		0.080		0.172
RSD	6.220		6.489		28.676
mean	2.052		1.517		5.155
median	2.052		1.517		5.155
maximum	2.180		1.616		6.633
minimum	1.925		1.419		3.677

Profile

Quantities

Labels

Position on Gel Image 'control_01'