Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13758' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13758 13758 13758 13758 13758 13758

Label AroA (no label) (no label) (no label) (no label) (no label)

X 450 385 385 361 375 392

Y 400 384 397 360 394 392

%V 0.9406 1.0769 1.1874 0.9130 0.6704 0.6376

Ratio - 1.041 0.648

p-value - 0.812 0.037

RSD 6.755 13.063 2.513

mean 1.009 1.050 0.654

median 1.009 1.050 0.654

maximum 1.077 1.187 0.670

minimum 0.941 0.913 0.638

	control	1 min	10 min

ID	13758	13758	13758	13758	13758	13758
Label	AroA	(no label)	(no label)	(no label)	(no label)	(no label)
X	450	385	385	361	375	392
Y	400	384	397	360	394	392
%V	0.9406	1.0769	1.1874	0.9130	0.6704	0.6376
Ratio	-	1.041	0.648
p-value	-	0.812	0.037
RSD	6.755	13.063	2.513
mean	1.009	1.050	0.654
median	1.009	1.050	0.654
maximum	1.077	1.187	0.670
minimum	0.941	0.913	0.638

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		AroA	AroA
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	1074	1074
	Protein Size (aa)	358	358
	Function
Uniprot	Accession	P39912
	Amino Acids	358
	Function
	Gene name	aroA
	Gene Ontology	F:3-deoxy-7-phosphoheptulonate synthase activity [GO:0003849] F:aldehyde-lyase activity [GO:0016832] F:chorismate mutase activity [GO:0004106] P:aromatic amino acid family biosynthetic process [GO:0009073] P:chorismate biosynthetic process [GO:0009423]
	Isoelectric Point	5.3532
	Keywords	Amino-acid biosynthesis Aromatic amino acid biosynthesis Complete proteome Isomerase Multifunctional enzyme Phosphoprotein Reference proteome Transferase
	Molecular Weight	39539.46
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	AroA
	Protein name	Protein AroA(G)
	Query text	AroA
	References	4 references
	Sequence	MSNTELELLRQKADELNLQILKLINERGNVVKEIGKAKEAQGVNRFDPVRERTMLNNIIE NNDGPFENSTIQHIFKEIFKAGLELQEEDHSKALLVSRKKKPEDTIVDIKGEKIGDGQQR FIVGPCAVESYEQVAEVAAAAKKQGIKILRGGAFKPRTSPYDFQGLGVEGLQILKRVADE FDLAVISEIVTPAHIEEALDYIDVIQIGARNMQNFELLKAAGAVKKPVLLKRGLAATISE FINAAEYIMSQGNDQIILCERGIRTYETATRNTLDISAVPILKQETHLPVFVDVTHSTGR RDLLLPTAKAALAIGADGVMAEVHPDPSVALSDSAQQMAIPEFEKWLNELKPMVKVNA
	Title	AROG_BACSU
	Uniprot entry	P39912

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13758	13758	13758	13758	13758	13758
Label	AroA	(no label)	(no label)	(no label)	(no label)	(no label)
X	450	385	385	361	375	392
Y	400	384	397	360	394	392
%V	0.9406	1.0769	1.1874	0.9130	0.6704	0.6376
Ratio	-		1.041		0.648
p-value	-		0.812		0.037
RSD	6.755		13.063		2.513
mean	1.009		1.050		0.654
median	1.009		1.050		0.654
maximum	1.077		1.187		0.670
minimum	0.941		0.913		0.638

Profile

Quantities

Labels

Position on Gel Image 'control_01'