The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13729' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.
| control | 1 min | 10 min | ||||
|---|---|---|---|---|---|---|
| control_01 | control_02 | 1min_01 | 1min_02 | 10min_01 | 10min_02 | |
|
|
|
|
|
|
|
| ID | 13729 | 13729 | 13729 | 13729 | 13729 | 13729 |
| Label | Icd | (no label) | (no label) | (no label) | (no label) | (no label) |
| X | 663 | 600 | 589 | 565 | 586 | 595 |
| Y | 360 | 341 | 359 | 330 | 357 | 358 |
| %V | 0.9661 | 1.0152 | 0.6386 | 0.6139 | 0.4767 | 0.5625 |
| Ratio | - | 0.632 | 0.525 | |||
| p-value | - | 0.006 | 0.011 | |||
| RSD | 2.480 | 1.970 | 8.255 | |||
| mean | 0.991 | 0.626 | 0.520 | |||
| median | 0.991 | 0.626 | 0.520 | |||
| maximum | 1.015 | 0.639 | 0.563 | |||
| minimum | 0.966 | 0.614 | 0.477 | |||
| Scout | Attribute | control | Fused Images |
|---|---|---|---|
| control_01 | Fused Image | ||
| Label name(s) | Icd | Icd | |
| Pi/MW Estimation | Pi | N.A. | N.A. |
| MW | N.A. | N.A. | |
| GenoList | Gene Size (bp) |
1269
|
1269
|
| Protein Size (aa) |
423
|
423
|
|
| Function |
|
|
|
| Uniprot | Accession |
P39126
|
|
| Amino Acids |
423
|
|
|
| Function |
|
|
|
| Gene name |
icd
|
|
|
| Gene Ontology |
|
|
|
| Isoelectric Point |
4.7444
|
|
|
| Keywords |
|
||
| Molecular Weight |
46417.77
|
|
|
| NCBI Taxonomy |
224308
|
|
|
| Organism |
Bacillus subtilis (strain 168)
|
|
|
| Original label name |
Icd
|
|
|
| Protein name |
Isocitrate dehydrogenase [NADP]
|
|
|
| Query text |
Icd
|
|
|
| References |
|
||
| Sequence |
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
|
|
|
| Title |
IDH_BACSU
|
|
|
| Uniprot entry |
|