Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13712' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13712 13712 13712 13712 13712 13712

Label EF-Tu (no label) (no label) (no label) (no label) (no label)

X 677 614 605 582 601 612

Y 316 299 316 288 315 319

%V 3.3689 3.5140 3.5442 4.9317 3.1383 2.8488

Ratio - 1.231 0.870

p-value - 0.372 0.110

RSD 2.109 16.369 4.835

mean 3.441 4.238 2.994

median 3.441 4.238 2.994

maximum 3.514 4.932 3.138

minimum 3.369 3.544 2.849

	control	1 min	10 min

ID	13712	13712	13712	13712	13712	13712
Label	EF-Tu	(no label)	(no label)	(no label)	(no label)	(no label)
X	677	614	605	582	601	612
Y	316	299	316	288	315	319
%V	3.3689	3.5140	3.5442	4.9317	3.1383	2.8488
Ratio	-	1.231	0.870
p-value	-	0.372	0.110
RSD	2.109	16.369	4.835
mean	3.441	4.238	2.994
median	3.441	4.238	2.994
maximum	3.514	4.932	3.138
minimum	3.369	3.544	2.849

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		EF-Tu	EF-Tu
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	0	0
	Protein Size (aa)	0	0
	Function
Uniprot	Accession	P33166
	Amino Acids	396
	Function	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
	Gene name	tuf
	Gene Ontology	C:cytoplasm [GO:0005737] C:intracellular [GO:0005622] F:GTP binding [GO:0005525] F:GTPase activity [GO:0003924] F:translation elongation factor activity [GO:0003746] P:translational elongation [GO:0006414]
	Isoelectric Point	4.6467
	Keywords	Complete proteome Cytoplasm Elongation factor GTP-binding Nucleotide-binding Protein biosynthesis Reference proteome
	Molecular Weight	43593.27
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	EF-Tu
	Protein name	Elongation factor Tu
	Query text	EF-Tu
	References	3 references
	Sequence	MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAITTVLHKKSGKGTAMAYDQIDGAPEERER GITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL EGDAEWEAKIFELMDAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV GDEVEIIGLQEENKKTTVTGVEMFRKLLDYAEAGDNIGALLRGVSREEIQRGQVLAKPGT ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIHLPEGVEMVMPGDNTE MNVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
	Title	EFTU_BACSU
	Uniprot entry	P33166

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13712	13712	13712	13712	13712	13712
Label	EF-Tu	(no label)	(no label)	(no label)	(no label)	(no label)
X	677	614	605	582	601	612
Y	316	299	316	288	315	319
%V	3.3689	3.5140	3.5442	4.9317	3.1383	2.8488
Ratio	-		1.231		0.870
p-value	-		0.372		0.110
RSD	2.109		16.369		4.835
mean	3.441		4.238		2.994
median	3.441		4.238		2.994
maximum	3.514		4.932		3.138
minimum	3.369		3.544		2.849

Profile

Quantities

Labels

Position on Gel Image 'control_01'