Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13627' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13627 13627 13627 13627 13627 13627

Label GtaB (no label) (no label) (no label) (no label) (no label)

X 612 544 538 506 536 536

Y 515 494 512 475 511 510

%V 0.2955 0.1720 0.4916 0.6976 0.3118 0.3104

Ratio - 2.543 1.331

p-value - 0.095 0.337

RSD 26.421 17.325 0.223

mean 0.234 0.595 0.311

median 0.234 0.595 0.311

maximum 0.296 0.698 0.312

minimum 0.172 0.492 0.310

	control	1 min	10 min

ID	13627	13627	13627	13627	13627	13627
Label	GtaB	(no label)	(no label)	(no label)	(no label)	(no label)
X	612	544	538	506	536	536
Y	515	494	512	475	511	510
%V	0.2955	0.1720	0.4916	0.6976	0.3118	0.3104
Ratio	-	2.543	1.331
p-value	-	0.095	0.337
RSD	26.421	17.325	0.223
mean	0.234	0.595	0.311
median	0.234	0.595	0.311
maximum	0.296	0.698	0.312
minimum	0.172	0.492	0.310

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		GtaB	GtaB
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	876	876
	Protein Size (aa)	292	292
	Function	glucosylation of teichoic acid	glucosylation of teichoic acid
Uniprot	Accession	Q05852
	Amino Acids	292
	Function	Catalyzes the formation of UDP-glucose from glucose-1-phosphate and UTP. This is an intermediate step in the biosynthesis of diglucosyl-diacylglycerol (Glc2-DAG), i.e. the predominant glycolipid found in B.subtilis membrane, which is also used as a membrane anchor for lipoteichoic acid (LTA). Has a role in the biosynthesis of all phosphate-containing envelope polymers, since UDP-glucose serves as a glucosyl donor not only for the biosynthesis of LTA but also for wall teichoic acids (WTAs). Is required for biofilm formation. This is likely due to another role of UDP-glucose, which might also act as a metabolic signal regulating biofilm formation or may be involved in some unknown biosynthetic pathway essential for biofilm formation, e.g. the synthesis of an exopolysaccharide.
	Gene name	gtaB
	Gene Ontology	F:UTP:glucose-1-phosphate uridylyltransferase activity [GO:0003983] P:enterobacterial common antigen biosynthetic process [GO:0009246] P:UDP-glucose metabolic process [GO:0006011]
	Isoelectric Point	4.8217
	Keywords	Carbohydrate metabolism Complete proteome Direct protein sequencing Nucleotidyltransferase Reference proteome Stress response Transferase
	Molecular Weight	33070.03
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	GtaB
	Protein name	UTP--glucose-1-phosphate uridylyltransferase
	Query text	GtaB
	References	6 references
	Sequence	MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS KRAIEDHFDYSPELERNLEEKGKTELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF IGDEPFAVLLGDDIVQAETPGLRQLMDEYEKTLSSIIGVQQVPEEETHRYGIIDPLTSEG RRYQVKNFVEKPPKGTAPSNLAILGRYVFTPEIFMYLEEQQVGAGGEIQLTDAIQKLNEI QRVFAYDFEGKRYDVGEKLGFITTTLEFAMQDKELRDQLVPFMEGLLNKEEI
	Title	GTAB_BACSU
	Uniprot entry	Q05852

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13627	13627	13627	13627	13627	13627
Label	GtaB	(no label)	(no label)	(no label)	(no label)	(no label)
X	612	544	538	506	536	536
Y	515	494	512	475	511	510
%V	0.2955	0.1720	0.4916	0.6976	0.3118	0.3104
Ratio	-		2.543		1.331
p-value	-		0.095		0.337
RSD	26.421		17.325		0.223
mean	0.234		0.595		0.311
median	0.234		0.595		0.311
maximum	0.296		0.698		0.312
minimum	0.172		0.492		0.310

Profile

Quantities

Labels

Position on Gel Image 'control_01'