Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13610' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13610 13610 13610 13610 13610 13610

Label PtsH (no label) (no label) (no label) (no label) (no label)

X 675 622 600 555 604 587

Y 997 950 986 931 991 976

%V 0.1271 0.0480 0.3460 0.3974 0.9250 0.4961

Ratio - 4.246 8.116

p-value - 0.026 0.104

RSD 45.170 6.918 30.178

mean 0.088 0.372 0.711

median 0.088 0.372 0.711

maximum 0.127 0.397 0.925

minimum 0.048 0.346 0.496

	control	1 min	10 min

ID	13610	13610	13610	13610	13610	13610
Label	PtsH	(no label)	(no label)	(no label)	(no label)	(no label)
X	675	622	600	555	604	587
Y	997	950	986	931	991	976
%V	0.1271	0.0480	0.3460	0.3974	0.9250	0.4961
Ratio	-	4.246	8.116
p-value	-	0.026	0.104
RSD	45.170	6.918	30.178
mean	0.088	0.372	0.711
median	0.088	0.372	0.711
maximum	0.127	0.397	0.925
minimum	0.048	0.346	0.496

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		PtsH	PtsH
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	264	264
	Protein Size (aa)	88	88
	Function	transfers phosphate from enzyme I to specific enzymes II/III permeases; mediates carbon catabolite repression (CCR)	transfers phosphate from enzyme I to specific enzymes II/III permeases; mediates carbon catabolite repression (CCR)
Uniprot	Accession	P08877
	Amino Acids	88
	Function	General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the permease (enzymes II/III).
	Gene name	ptsH
	Gene Ontology	C:cytoplasm [GO:0005737] F:protein serine/threonine kinase activity [GO:0004674] P:phosphoenolpyruvate-dependent sugar phosphotransferase system [GO:0009401] P:regulation of carbohydrate utilization [GO:0043610] P:regulation of transcription, DNA-templated [GO:0006355] P:transcription, DNA-templated [GO:0006351]
	Isoelectric Point	4.5183
	Keywords	3D-structure Complete proteome Cytoplasm Direct protein sequencing Kinase Phosphoprotein Phosphotransferase system Reference proteome Serine/threonine-protein kinase Sugar transport Transcription Transcription regulation Transferase Transport
	Molecular Weight	9189.36
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	PtsH
	Protein name	Phosphocarrier protein HPr
	Query text	PtsH
	References	13 references
	Sequence	MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAE ITISASGADENDALNALEETMKSEGLGE
	Title	PTHP_BACSU
	Uniprot entry	P08877

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13610	13610	13610	13610	13610	13610
Label	PtsH	(no label)	(no label)	(no label)	(no label)	(no label)
X	675	622	600	555	604	587
Y	997	950	986	931	991	976
%V	0.1271	0.0480	0.3460	0.3974	0.9250	0.4961
Ratio	-		4.246		8.116
p-value	-		0.026		0.104
RSD	45.170		6.918		30.178
mean	0.088		0.372		0.711
median	0.088		0.372		0.711
maximum	0.127		0.397		0.925
minimum	0.048		0.346		0.496

Profile

Quantities

Labels

Position on Gel Image 'control_01'