Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13432' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13432 13432 13432 13432 13432 13432

Label RsbW (no label) (no label) (no label) (no label) (no label)

X 866 790 783 725 800 768

Y 776 739 769 729 770 767

%V 0.3254 0.0823 0.3861 0.2280 0.1631 0.1042

Ratio - 1.506 0.656

p-value - 0.550 0.631

RSD 59.615 25.741 22.015

mean 0.204 0.307 0.134

median 0.204 0.307 0.134

maximum 0.325 0.386 0.163

minimum 0.082 0.228 0.104

	control	1 min	10 min

ID	13432	13432	13432	13432	13432	13432
Label	RsbW	(no label)	(no label)	(no label)	(no label)	(no label)
X	866	790	783	725	800	768
Y	776	739	769	729	770	767
%V	0.3254	0.0823	0.3861	0.2280	0.1631	0.1042
Ratio	-	1.506	0.656
p-value	-	0.550	0.631
RSD	59.615	25.741	22.015
mean	0.204	0.307	0.134
median	0.204	0.307	0.134
maximum	0.325	0.386	0.163
minimum	0.082	0.228	0.104

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		RsbW	RsbW
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	480	480
	Protein Size (aa)	160	160
	Function	negative regulation of sigma-B-dependent gene expression; phosphorylation of RsbV	negative regulation of sigma-B-dependent gene expression; phosphorylation of RsbV
Uniprot	Accession	P17904
	Amino Acids	160
	Function	Negative regulator of sigma-B activity. Phosphorylates and inactivates its specific antagonist protein, RsbV. Upon phosphorylation of RsbV, RsbW is released and binds to sigma-B, thereby blocking its ability to form an RNA polymerase holoenzyme (E-sigma-B).
	Gene name	rsbW
	Gene Ontology	F:ATP binding [GO:0005524] F:protein serine/threonine kinase activity [GO:0004674] F:sigma factor antagonist activity [GO:0016989] P:negative regulation of transcription, DNA-templated [GO:0045892]
	Isoelectric Point	4.231
	Keywords	ATP-binding Complete proteome Direct protein sequencing Kinase Nucleotide-binding Reference proteome Serine/threonine-protein kinase Stress response Transferase
	Molecular Weight	17993.0
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	RsbW
	Protein name	Serine-protein kinase RsbW
	Query text	RsbW
	References	9 references
	Sequence	MKNNADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKIAVSEACTNAVQHAYK EDKNGEVSIRFGVFEDRLEVIVADEGDSFDFDQKQQDLGPYTPSHTVDQLSEGGLGLYLM ETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTTIKNYETN
	Title	RSBW_BACSU
	Uniprot entry	P17904

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13432	13432	13432	13432	13432	13432
Label	RsbW	(no label)	(no label)	(no label)	(no label)	(no label)
X	866	790	783	725	800	768
Y	776	739	769	729	770	767
%V	0.3254	0.0823	0.3861	0.2280	0.1631	0.1042
Ratio	-		1.506		0.656
p-value	-		0.550		0.631
RSD	59.615		25.741		22.015
mean	0.204		0.307		0.134
median	0.204		0.307		0.134
maximum	0.325		0.386		0.163
minimum	0.082		0.228		0.104

Profile

Quantities

Labels

Position on Gel Image 'control_01'