Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13405' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13405 13405 13405 13405 13405 13405

Label AhpC (no label) (no label) (no label) (no label) (no label)

X 875 796 790 736 807 768

Y 692 658 683 648 686 687

%V 0.0439 0.0329 0.0246 0.0857 0.2203 0.1208

Ratio - 1.435 4.437

p-value - 0.644 0.119

RSD 14.297 55.325 29.165

mean 0.038 0.055 0.171

median 0.038 0.055 0.171

maximum 0.044 0.086 0.220

minimum 0.033 0.025 0.121

	control	1 min	10 min

ID	13405	13405	13405	13405	13405	13405
Label	AhpC	(no label)	(no label)	(no label)	(no label)	(no label)
X	875	796	790	736	807	768
Y	692	658	683	648	686	687
%V	0.0439	0.0329	0.0246	0.0857	0.2203	0.1208
Ratio	-	1.435	4.437
p-value	-	0.644	0.119
RSD	14.297	55.325	29.165
mean	0.038	0.055	0.171
median	0.038	0.055	0.171
maximum	0.044	0.086	0.220
minimum	0.033	0.025	0.121

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		AhpC	AhpC
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	561	561
	Protein Size (aa)	187	187
	Function
Uniprot	Accession	P80239
	Amino Acids	187
	Function	Directly reduces organic hydroperoxides in its reduced dithiol form.
	Gene name	ahpC
	Gene Ontology	F:peroxidase activity [GO:0004601] F:peroxiredoxin activity [GO:0051920] P:response to oxidative stress [GO:0006979]
	Isoelectric Point	4.2224
	Keywords	Antioxidant Complete proteome Direct protein sequencing Disulfide bond Oxidoreductase Peroxidase Redox-active center Reference proteome Stress response
	Molecular Weight	20627.12
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	AhpC
	Protein name	Alkyl hydroperoxide reductase subunit C
	Query text	AhpC
	References	4 references
	Sequence	MSLIGKEVLPFEAKAFKNGEFIDVTNEDLKGQWSVFCFYPADFSFVCPTELEDLQEQYAA LKELGVEVYSVSTDTHFVHKGWHDSSEKISKITYAMIGDPSQTISRNFDVLDEETGLADR GTFIIDPDGVIQTVEINAGGIGRDASNLVNKVKAAQYVRQNPGEVCPAKWEEGGETLTPS LDLVGKI
	Title	AHPC_BACSU
	Uniprot entry	P80239

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13405	13405	13405	13405	13405	13405
Label	AhpC	(no label)	(no label)	(no label)	(no label)	(no label)
X	875	796	790	736	807	768
Y	692	658	683	648	686	687
%V	0.0439	0.0329	0.0246	0.0857	0.2203	0.1208
Ratio	-		1.435		4.437
p-value	-		0.644		0.119
RSD	14.297		55.325		29.165
mean	0.038		0.055		0.171
median	0.038		0.055		0.171
maximum	0.044		0.086		0.220
minimum	0.033		0.025		0.121

Profile

Quantities

Labels

Position on Gel Image 'control_01'