Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13220' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13220 13220 13220 13220 13220 13220

Label EF-Ts (no label) (no label) (no label) (no label) (no label)

X 589 523 515 486 513 517

Y 470 453 468 433 466 467

%V 1.2874 1.2707 0.8154 1.0690 0.2226 0.2504

Ratio - 0.737 0.185

p-value - 0.118 0.000

RSD 0.654 13.460 5.892

mean 1.279 0.942 0.237

median 1.279 0.942 0.237

maximum 1.287 1.069 0.250

minimum 1.271 0.815 0.223

	control	1 min	10 min

ID	13220	13220	13220	13220	13220	13220
Label	EF-Ts	(no label)	(no label)	(no label)	(no label)	(no label)
X	589	523	515	486	513	517
Y	470	453	468	433	466	467
%V	1.2874	1.2707	0.8154	1.0690	0.2226	0.2504
Ratio	-	0.737	0.185
p-value	-	0.118	0.000
RSD	0.654	13.460	5.892
mean	1.279	0.942	0.237
median	1.279	0.942	0.237
maximum	1.287	1.069	0.250
minimum	1.271	0.815	0.223

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		EF-Ts	EF-Ts
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	0	0
	Protein Size (aa)	0	0
	Function
Uniprot	Accession	P80700
	Amino Acids	293
	Function	Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome (By similarity).
	Gene name	tsf
	Gene Ontology	C:cytoplasm [GO:0005737] F:translation elongation factor activity [GO:0003746]
	Isoelectric Point	4.9005
	Keywords	Complete proteome Cytoplasm Direct protein sequencing Elongation factor Phosphoprotein Protein biosynthesis Reference proteome
	Molecular Weight	32353.77
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	EF-Ts
	Protein name	Elongation factor Ts
	Query text	EF-Ts
	References	3 references
	Sequence	MAITAQQVKELREKTGAGMMDCKKALTETDGDMDKAIDLLREKGIAKAAKKADRIAAEGS TLIKTDGNKGVILEVNSETDFVAKNEGFKELLNTLADHLLANTPADVEEAMGQKMENGST VEEYITSAVAKIGEKITLRRFTVLTKDDSSAFGAYLHMGGRIGVLTVLNGTTDEETAKDI AMHVAAVNPRYISRDQVSEEETNHERQILTQQALQEGKPENIVAKMVEGRLNKFFEEICL LDQAFVKNPDEKVKQVIAAKNATVQTFVRYEVGEGIEKRQENFAEEVMNQVKK
	Title	EFTS_BACSU
	Uniprot entry	P80700

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13220	13220	13220	13220	13220	13220
Label	EF-Ts	(no label)	(no label)	(no label)	(no label)	(no label)
X	589	523	515	486	513	517
Y	470	453	468	433	466	467
%V	1.2874	1.2707	0.8154	1.0690	0.2226	0.2504
Ratio	-		0.737		0.185
p-value	-		0.118		0.000
RSD	0.654		13.460		5.892
mean	1.279		0.942		0.237
median	1.279		0.942		0.237
maximum	1.287		1.069		0.250
minimum	1.271		0.815		0.223

Profile

Quantities

Labels

Position on Gel Image 'control_01'