Delta2D Expression Profile

Profile

Quantities

The table shows normalized volumes (%Vol) of the visible expression profile for spot ID '13196' on gel image 'control_01'.
Ratios and p-values (using t-Tests) are computed relative to group 'control'.

control 1 min 10 min

control_01 control_02 1min_01 1min_02 10min_01 10min_02

ID 13196 13196 13196 13196 13196 13196

Label Mdh (no label) (no label) (no label) (no label) (no label)

X 690 630 617 590 615 621

Y 448 427 446 415 446 447

%V 1.2073 1.2554 0.7600 1.0425 1.2571 1.2396

Ratio - 0.732 1.014

p-value - 0.148 0.575

RSD 1.953 15.673 0.699

mean 1.231 0.901 1.248

median 1.231 0.901 1.248

maximum 1.255 1.043 1.257

minimum 1.207 0.760 1.240

	control	1 min	10 min

ID	13196	13196	13196	13196	13196	13196
Label	Mdh	(no label)	(no label)	(no label)	(no label)	(no label)
X	690	630	617	590	615	621
Y	448	427	446	415	446	447
%V	1.2073	1.2554	0.7600	1.0425	1.2571	1.2396
Ratio	-	0.732	1.014
p-value	-	0.148	0.575
RSD	1.953	15.673	0.699
mean	1.231	0.901	1.248
median	1.231	0.901	1.248
maximum	1.255	1.043	1.257
minimum	1.207	0.760	1.240

Labels

Scout	Attribute	control	Fused Images
		control_01	Fused Image
Label name(s)		Mdh	Mdh
Pi/MW Estimation	Pi	N.A.	N.A.
	MW	N.A.	N.A.
GenoList	Gene Size (bp)	936	936
	Protein Size (aa)	312	312
	Function
Uniprot	Accession	P49814
	Amino Acids	312
	Function	Catalyzes the reversible oxidation of malate to oxaloacetate.
	Gene name	mdh
	Gene Ontology	F:L-malate dehydrogenase activity [GO:0030060] P:carbohydrate metabolic process [GO:0005975] P:tricarboxylic acid cycle [GO:0006099]
	Isoelectric Point	4.6439
	Keywords	Complete proteome Direct protein sequencing NAD Oxidoreductase Phosphoprotein Reference proteome Tricarboxylic acid cycle
	Molecular Weight	33643.53
	NCBI Taxonomy	224308
	Organism	Bacillus subtilis (strain 168)
	Original label name	Mdh
	Protein name	Malate dehydrogenase
	Query text	Mdh
	References	6 references
	Sequence	MGNTRKKVSVIGAGFTGATTAFLIAQKELADVVLVDIPQLENPTKGKALDMLEASPVQGF DAKITGTSNYEDTAGSDIVVITAGIARKPGMSRDDLVSTNEKIMRSVTQEIVKYSPDSII VVLTNPVDAMTYAVYKESGFPKERVIGQSGVLDTARFRTFVAEELNLSVKDVTGFVLGGH GDDMVPLVRYSYAGGIPLETLIPKERIDAIVERTRKGGGEIVNLLGNGSAYYAPAASLTE MVEAILKDQRRVLPTIAYLEGEYGYEGIYLGVPTIVGGNGLEQIIELELTDYERAQLNKS VESVKNVMKVLS
	Title	MDH_BACSU
	Uniprot entry	P49814

	control		1 min		10 min
	control_01	control_02	1min_01	1min_02	10min_01	10min_02

ID	13196	13196	13196	13196	13196	13196
Label	Mdh	(no label)	(no label)	(no label)	(no label)	(no label)
X	690	630	617	590	615	621
Y	448	427	446	415	446	447
%V	1.2073	1.2554	0.7600	1.0425	1.2571	1.2396
Ratio	-		0.732		1.014
p-value	-		0.148		0.575
RSD	1.953		15.673		0.699
mean	1.231		0.901		1.248
median	1.231		0.901		1.248
maximum	1.255		1.043		1.257
minimum	1.207		0.760		1.240

Profile

Quantities

Labels

Position on Gel Image 'control_01'